Everything below concerns thymosin beta-4. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-10-29. Numbers and descriptions here follow the published literature rather than marketing material.
TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.
Thymosin beta-4 was isolated from calf thymus in the early 1980s and later characterised as an abundant intracellular actin-sequestering protein. Interest in short synthetic fragments grew once the actin-binding motif had been mapped to the middle of the sequence. TB-500 came out of that line of work as a truncated analogue rather than a natural isolate, and it is now sold mainly to laboratories. Published studies on the fragment have been largely in vitro or in animal models, and controlled human trials remain sparse, so claims about effects in people rest on extrapolation.
TB-500 is a synthetic seven-amino-acid peptide with the sequence LKKTETQ, corresponding to residues 17 through 23 of the protein thymosin beta-4. The N-terminus is typically acetylated in the described form, giving a monoisotopic mass near 888.5 Da and an average mass of about 889 Da. The designation TB-500 is a catalogue label rather than a formal chemical name, and the same sequence appears in the literature under several alternative abbreviations. It is handled as a research reagent rather than a pharmaceutical product.
Thymosin beta-4 is a 43-residue actin-binding protein found in most mammalian cell types, where it participates in cytoskeletal regulation and cell migration. TB-500 represents only a short fragment of that protein and does not include the remaining residues. Whether the isolated fragment reproduces the full range of activities reported for the intact protein remains an open question. Researchers commonly treat the two as related but distinct entities when comparing results.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Supplied as a lyophilised cake in sealed vials |
| Solubility class | Freely soluble in water | Polar and charged side chains dominate the sequence |
| Typical storage temperature | -20 °C or below | Dry and dark; a desiccant is often recommended |
| Identity confirmation | Mass spectrometry | Observed mass compared with the theoretical value |
| Common synonyms | Thymosin beta-4 fragment | Also written as T beta 4 fragment 17-23 |
Detection in biological matrices generally relies on liquid chromatography coupled with tandem mass spectrometry, because the peptide lacks a convenient ultraviolet chromophore beyond the amide backbone. Immunoassays have been described, but antibodies raised against the fragment can cross-react with the full-length protein or with unrelated peptides, so findings usually require confirmation by a second technique. Sample preparation typically involves protein precipitation followed by solid-phase extraction. Reported detection windows depend on dose, route, matrix, and instrument sensitivity.
Lyophilised material is stable for extended periods when kept dry and cold, and suppliers typically recommend storage well below freezing. Once dissolved, the peptide is handled at refrigeration temperatures and used within a short period, because peptide bonds and the acetylated terminus can be affected by repeated freeze-thaw cycles, proteases, or extreme pH. Bacteriostatic water and saline are both described as solvents, although preservatives can interfere with some analytical workflows. Reconstituted solutions are inspected for particulates before use.
Identity and purity are checked with chromatographic and mass spectrometric methods. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities, while mass spectrometry confirms the expected molecular mass. A certificate of analysis may report a purity percentage, but the laboratory should still verify the material independently. Common quality concerns include truncated sequences, deamidation, oxidation, and residual solvents from synthesis. Because TB-500 is short, some impurities can differ from the target by only a few mass units.
Reconstitution practices affect downstream measurements. The dry powder is typically dissolved in sterile water or a suitable aqueous buffer, then mixed gently rather than vortexed at high speed. Visible particles or cloudiness suggest incomplete dissolution or contamination and should be investigated. For long-term storage, aliquots should be labeled with concentration, solvent, and date. Open questions include how different buffers alter peptide conformation and whether specific container materials adsorb the peptide. Those variables can change apparent concentration in assays even when the chemical identity is correct.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
==== Respiratory system ==== The respiratory system allows for gas exchange, particularly of carbon dioxide and oxygen, in human beings. In the process of breathing or ventilation, the muscles of respiration pump air into the lungs, bringing it into close contact with the blood via millions of microscopic air sacs known as alveoli. The upper respiratory tract includes the nose, nasal cavities, sinuses, pharynx and the part of the larynx above the vocal folds; the lower tract includes the lower part of the larynx and the following aiways: the trachea, bronchi, bronchioles and alveoli. The lungs are surrounded by flattened closed sacs known as pleura.
==== Europe ==== In 2008, the European Monitoring Centre for Drugs and Drug Addiction noted that although there were some reports of tablets being sold for as little as €1, most countries in Europe then reported typical retail prices in the range of €3 to €9 per tablet, typically containing 25–65 mg of MDMA. By 2014 the EMCDDA reported that the range was more usually between €5 and €10 per tablet, typically containing 57–102 mg of MDMA, although MDMA in powder form was becoming more common.
Sources: en.wikipedia.org
This California-based project is working to combat the negative perception with mental health and reduce the stigma associated with it. While social media can benefit mental health, it can also lead to deterioration if not managed properly. Limiting social media intake is beneficial. Studies report that patients in mental health care who can access and read their Electronic Health Records (EHR) or Open Notes online experience increased understanding of their mental health, feeling in control of their care, and enhanced trust in their clinicians. Patients' also reported feelings of greater validation, engagement, remembering their care plan, and acquiring a better awareness of potential side effects of their medications, when reading their mental health notes. Other common experiences were that shared mental health notes enhance patient empowerment and augment patient autonomy. Furthermore, recent studies have shown that social media is an effective way to draw attention to mental health issues. By collecting data from Twitter, researchers found that social media presence is heightened after an event relating to behavioral health occurs. Researchers continue to find effective ways to use social media to bring more awareness to mental health issues through online campaigns in other sites such as Facebook and Instagram.
=== Sex pheromone === The sex pheromone of the American cockroach is the sequiterpene (1Z,5E)-1,10(14)-diepoxy-4(15),5-germacradien-9-one, which has been given the trivial name periplanone-B. This pheromone was isolated from the feces of virgin female cockroaches. Previously, 2,2-dimethyl-3-isopropylidenecyclopropyl propionate had been thought to be the structure of this pheromone, but on synthesis was shown to be inactive. The structure determination of this pheromone was an eventful chapter in the history of pheromone chemistry.
== Species distribution == BHBDH is found in dogfish sharks (Squalus acanthias) rectal glands and has been found to have a large increase in activity in activity after feeding. The largest and most significant peak of BHBDH activity occurred 4–8 hours in the rectal glands of the sharks. Besides dogfish, this enzyme is found in a large range of organisms all the way from unicellular organisms to higher order primates such as humans. In humans, this enzyme is used medically in diabetes patients to detect ketone bodies which are associated with diabetic ketoacidosis. This is by no means an exhaustive list of organisms where BHBDH is found, these organisms are merely some of the common examples of this enzyme in action.
Sources: en.wikipedia.org
No. Thymosin beta-4 is a 43-residue protein, while TB-500 matches only residues 17 to 23 of that chain. The two are related but differ in size, and a method that identifies one does not automatically identify the other.
It corresponds to the actin-binding region of thymosin beta-4. Commercial synthesis reproduces that seven-residue stretch, usually with an acetyl group on the N-terminus.
It is not authorised as a medicine in the United States or the European Union and is distributed as a research chemical. Labels consequently carry research-use-only statements rather than clinical indications.
No. TB-500 is a short synthetic peptide matching residues 17 to 23 of thymosin beta-4, while the parent protein contains 43 residues. The fragment lacks the rest of the protein sequence, so the two are related but not identical.