If you have been reading about retention time and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-09-10. Numbers and descriptions here follow the published literature rather than marketing material.
Method validation establishes that an HPLC procedure is suitable for its intended purpose. Typical parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, robustness, and solution stability. Accuracy reflects closeness to a reference value, while precision reflects agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from matrix components. Validation is documented through protocols and reports, and the required extent depends on the method's use and regulatory context.
Routine quality control uses system suitability, blank injections, check standards, and control samples to detect drift or contamination. System suitability criteria may specify minimum resolution, maximum tailing factor, and a permitted range for repeated injections. Blank injections reveal carryover or solvent contamination, while check standards confirm calibration accuracy over a batch. Control samples with known analyte levels can show whether results remain within statistical limits. When a control result falls outside limits, the analyst investigates the cause and may invalidate affected results before repeating the batch.
Documentation and traceability are central to regulated HPLC testing. Records typically include instrument logs, column history, mobile-phase preparation, sample preparation, injection sequences, raw chromatograms, and audit trails. Electronic systems may require user access controls, time-stamped changes, and backup procedures. Training records show that analysts are qualified for assigned methods. Audits and inspections check whether written procedures match actual practice and whether deviations are documented. These controls support reproducibility and allow results to be reconstructed if questions arise later.
High-performance liquid chromatography, or HPLC, separates dissolved compounds by passing a liquid mobile phase through a packed column. Components distribute differently between the stationary phase and the moving liquid, so they travel at different speeds and exit at different times. A detector records these eluting bands as peaks, and peak area or height relates to amount. The technique supports testing in pharmaceuticals, foods, environmental samples, and industrial chemicals. Quantification usually depends on calibration with known standards.
Several separation modes exist, including reversed-phase, normal-phase, ion-exchange, size-exclusion, and hydrophilic interaction liquid chromatography. Reversed-phase uses a nonpolar stationary phase with a polar mobile phase and is widely applied to small organic molecules. Gradient elution changes mobile phase composition during the run, while isocratic elution keeps it constant. Column chemistry, particle size, temperature, flow rate, and mobile phase pH all influence retention and resolution. Method development selects conditions that separate analytes from matrix components and from each other.
| Property | Value | Notes |
|---|---|---|
| Accuracy | Recovery near 100% | Depends on acceptance criteria and matrix |
| Precision | Relative standard deviation | Often at or below 2% for replicate injections |
| Limit of detection | Signal-to-noise ratio 3:1 | Approximate and method-specific |
| Limit of quantitation | Signal-to-noise ratio 10:1 | Confirmed by precision and accuracy |
| Resolution | 1.5 or greater | Typical system suitability target |
Validation establishes that a method is suitable for its intended purpose. Typical parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, robustness, and stability of standards and samples. Acceptance criteria are defined in advance, and results are documented in a validation report. Regulatory guidance for pharmaceuticals, foods, and environmental testing differs, so the applicable framework must be identified. Ongoing verification uses control samples and trend charts after validation. Method transfer to another laboratory may require partial revalidation.
Routine quality control includes blanks, duplicates, spiked samples, and certified reference materials. Calibration curves are prepared with standards at several concentrations, and the detector response is checked for linearity. Carryover, column aging, mobile phase evaporation, and temperature drift can shift retention times or peak areas. Maintenance such as replacing seals, filters, and columns helps prevent failures. Records of injections, integration, and deviations support traceability. Audits may request raw data and instrument logs for each batch.
HPLC testing separates dissolved compounds by passing a liquid sample through a column packed with stationary phase. A pump delivers mobile phase at controlled flow, and the sample components interact differently with stationary and mobile phases. Compounds that spend more time in mobile phase elute earlier; those retained by stationary phase elute later. Detectors record elution as peaks, and peak area or height relates to amount. This mechanism underpins quantitative analysis of mixtures.
Most routine HPLC testing uses reversed-phase columns, where the stationary phase is nonpolar and the mobile phase is a polar mixture such as water with an organic solvent. Analytes partition between the two phases according to polarity, size, and charge. Gradients that change solvent composition over time can separate compounds with broad retention ranges. Isocratic conditions keep solvent composition constant and suit simpler mixtures. The choice of column chemistry, pH, and temperature affects selectivity and peak shape.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. UV detection is widely used because many organic compounds absorb light, but it requires a chromophore. Mass spectrometry provides mass-based identification and high sensitivity for trace analytes. Each detector has trade-offs in selectivity, cost, and compatibility with mobile phases. Quantification typically uses calibration curves prepared from reference standards. Results are reported as concentration, purity, or presence above a limit.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
Method validation establishes that an HPLC procedure is suitable for its intended use. Key parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Accuracy measures agreement with a true or accepted value, while precision describes repeatability and intermediate precision. Specificity confirms that the method measures the analyte without interference from impurities, degradants, or excipients. Validation is documented in a protocol and report, and acceptance criteria are set before experiments begin. Regulatory guidance varies by region, but the general principles are widely harmonized.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
Sources: en.wikipedia.org
In order to regulate the secretion of ACTH, many substances secreted within this axis exhibit slow/intermediate and fast feedback-loop activity. Glucocorticoids secreted from the adrenal cortex work to inhibit CRH secretion by the hypothalamus, which in turn decreases anterior pituitary secretion of ACTH. Glucocorticoids may also inhibit the rates of POMC gene transcription and peptide synthesis. The latter is an example of a slow feedback loop, which works on the order of hours to days, whereas the former works on the order of minutes. The half-life of ACTH in human blood is reported to be between ten and 30 minutes. ACTH consists of 39 amino acids, the first 13 of which (counting from the N-terminus) may be cleaved to form α-melanocyte-stimulating hormones (α-MSH) (this common structure is responsible for excessively tanned skin in Addison's disease). After a short period of time, ACTH is cleaved into α-melanocyte-stimulating hormone (α-MSH) and CLIP, a peptide with unknown activity in humans. In the human body, total weight ACTH is 4540 Da.
Absolute bioavailability compares the bioavailability of the active drug in systemic circulation following non-intravenous administration (i.e., after oral, buccal, ocular, nasal, rectal, transdermal, subcutaneous, or sublingual administration), with the bioavailability of the same drug following intravenous administration. It is the fraction of exposure to a drug (AUC) through non-intravenous administration compared with the corresponding intravenous administration of the same drug. The comparison must be dose normalized (e.g., account for different doses or varying weights of the subjects); consequently, the amount absorbed is corrected by dividing the corresponding dose administered. In pharmacology, in order to determine absolute bioavailability of a drug, a pharmacokinetic study must be done to obtain a plasma drug concentration vs time plot for the drug after both intravenous (iv) and extravascular (non-intravenous, i.e., oral) administration. The absolute bioavailability is the dose-corrected area under curve (AUC) non-intravenous divided by AUC intravenous. The formula for calculating the absolute bioavailability, F, of a drug administered orally (po) is given below (where D is dose administered).
The presentation of amyloidosis is broad and depends on the site of amyloid accumulation. The kidney and heart are the most common organs involved. Amyloid deposition in the kidney often involve the glomerular capillaries and mesangial regions, affecting the organ's ability to filter and excrete waste and retain plasma protein. This can lead to high levels of protein in the urine (proteinuria) and nephrotic syndrome. Several types of amyloidosis, including the AL and AA types, are associated with nephrotic syndrome. Approximately 20% and 40–60% of people with AL and AA amyloidosis respectively progress to end-stage kidney disease requiring dialysis.
Vasoactive intestinal peptide (VIP) is a 28-residue amino acid peptide first characterized in 1970 that was initially isolated from porcine duodenum. A member of the secretin/glucagon hormone superfamily, VIP was initially discovered owing to its potent vasodilatory effects (as its name implies). VIP is widely distributed in the central and peripheral nervous system as well as in the digestive, respiratory, reproductive, and cardiovascular systems as a neurotransmitter and neuroendocrine releasing factor. These effects contribute to an extensive range of physiological and pathological processes related to development, growth, and the control of neuronal, epithelial, and endocrine cell function. VIP acts on two receptors - VPAC1 and VPAC2, which are class B of G-protein-coupled receptors (GPCRs).VPAC1 is mainly present in the lung and T-lymphocytes, whereas VPAC2 is mainly seen in the smooth muscle, mast cells and the basal parts of the lung mucosa.
Sources: en.wikipedia.org
Validation establishes suitability for a new method, while verification confirms that a method works in a specific laboratory. Verification is often used when a validated method is adopted with existing equipment and staff. Both rely on documented acceptance criteria.
Quantification usually compares detector response to a standard curve made from reference standards. The curve may be external, internal, or based on standard addition depending on matrix effects. Results are reported with units and, when required, uncertainty.
Carryover occurs when analyte from a previous injection remains in the system and appears in a later chromatogram. It can come from the injector, column, or tubing. Blank injections and needle washes help detect and reduce it.
HPLC separates and quantifies compounds in a liquid sample. Detectors produce a response proportional to the amount of a compound passing through the flow cell. Identification by retention time requires comparison with a known standard.